abdur16smith abdur16smith

Today at 4:39 AM
Health

Answered

Design a flexibility routine for a minimum of 5 major muscle groups which centers on the training principle of progression.

Answer :

jayjayy14ftm jayjayy14ftm

Today at 4:44 AM

1) Static
2) Active
3) Proprioceptive Neuromuscular Facilitation
4) Passive
5) Isometric
6) Dynamic
7) Ballistic

Answer Link

Other Questions

9. Sarah has a 3-Kilogram block and a 5-kilogram block. When would a block's gravitational force on Sarah be the strongest?

In the year 1859, Thomas Austin imported 24 rabbits from England to his property in Australia for sport hunting. Australia has mild winters with no natural pred

It’s illegal to hack into a system without authorization, but is it ethical for a gray-hat to hack into a system if the intent is to help it become more secure?

What are the producers in the food web? How does energy move through the food web worksheet 5th grade science

What is the answer help me.

Add the following rational number 1= 2/-3+-7/12+5/6

Which of the following species are restricted to a given area [JIPMER 2001; BHU 2004] A) Sympatric species B) Allopatric species C) Sibling species D) Endemic s

Solve for market price and quantity by setting the following

computer is a boon or a bane

contour line drawings

Complete each statement with the correct vocabulary word or words. A device that uses an electromagnet to measure electric current is a(n) .

A candidate for office claims that "there is a correlation between television watching and crime." Criticize this statement on statistical grounds.

A consumer group wants to test the effectiveness of a new "organic " laundry detergent and make recommendations to customer s about how to best use the product.

Draw and label each of the following. a line containing X and Y

A crossed belt connects a 20-centimeter pulley (10-cm radius) on an electric motor with a 40-centimeter pulley (20-cm radius) on a saw arbor. The electric motor

A first-order reaction is 75.0% complete in 320 s. What are the first and second half-lives for this reaction?

PLS can someone help me? volume of cylinders...

Draw and label each of the following. a pair of opposite rays that both contain R

Select the best answer. A Gallup Poll found that only 28% of American adults expect to inherit money or valuable possessions from a relative. The poll's margin

A membrane protein has the following amino acid sequence: EWDRHDFESGPTFIWLIWLVLAVLFLLLWAVLRPGKYKDKHE Considering the R groups on the amino acids, predict the re